Bio-Rad, AHP2207, Human Immunodeficiency Virus 1 gp41 antibody
Size: 1 mg, Goat anti Human Immunodeficiency Virus 1 gp41
Catalog Number: AHP2207
Send an RFQ.
Category
Pack Size1 mg
Loading…
| Target Species | Viral |
|---|---|
| Product Form | Purified IgG - liquid |
| Preservative Stabilisers | <0.1% Sodium Azide (NaN 3 ) |
| Immunogen | Synthetic peptide CH 3 CO-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH 2 . |
| Regulatory | For research purposes only |
| Guarantee | 12 months from date of despatch |
| Product Type | Polyclonal Antibody |
| Isotype | Polyclonal IgG |
| Specificity | Human Immunodeficiency Virus 1 gp41 |
| Buffer Solution | Phosphate buffered saline |
| Approx. Protein Concentrations | IgG concentration 1.0 mg/ml |
| UniProt | Q70626 |
| GO Terms | GO:0006915 apoptosis |
| Synonyms | HIV-1 |
| RRID | AB_10851403 |
| Purity | >98% |
Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:
Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.
