Proteintech, 13433-1-AP-150ul, ACYP1 Polyclonal antibody

Name: ACYP1 Polyclonal antibody
Brand: Proteintech
SKU: 13433-1-AP-150ul

The ACYP1 (13433-1-AP) by Proteintech is a Polyclonal antibody targeting ACYP1 in WB, ELISA applications with reactivity to human, mouse, rat samples

Available Catalog Numbers

Catalog Number: 13433-1-AP-150ul

Pricing

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag4237 Product name: Recombinant human ACYP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC035568 Sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK Predict reactive species
Full Name	acylphosphatase 1, erythrocyte (common) type
Calculated Molecular Weight	99 aa, 11 kDa
Observed Molecular Weight	11 kDa
GenBank Accession Number	BC035568
Gene Symbol	ACYP1
Gene ID (NCBI)	97
RRID	AB_2242288
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P07311
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Ordering

Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:

[email protected]

Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.

More from Proteintech.