Proteintech, 20410-1-AP-150ul, ACN9 Polyclonal antibody

Name: ACN9 Polyclonal antibody
Brand: Proteintech
SKU: 20410-1-AP-150ul

The ACN9 (20410-1-AP) by Proteintech is a Polyclonal antibody targeting ACN9 in WB, ELISA applications with reactivity to human samples

Available Catalog Numbers

Catalog Number: 20410-1-AP-150ul

Pricing

Tested Reactivity	human
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14242 Product name: Recombinant human ACN9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-125 aa of BC022858 Sequence: KSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF Predict reactive species
Full Name	ACN9 homolog (S. cerevisiae)
Calculated Molecular Weight	125 aa, 15 kDa
Observed Molecular Weight	15 kDa
GenBank Accession Number	BC022858
Gene Symbol	ACN9
Gene ID (NCBI)	57001
RRID	AB_3085604
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NRP4
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Ordering

Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:

[email protected]

Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.

More from Proteintech.