Proteintech, 21071-1-AP-20ul, ADORA2B Polyclonal antibody

Name: ADORA2B Polyclonal antibody
Brand: Proteintech
SKU: 21071-1-AP-20ul

The ADORA2B (21071-1-AP) by Proteintech is a Polyclonal antibody targeting ADORA2B in WB, ELISA applications with reactivity to human, mouse samples

Available Catalog Numbers

Catalog Number: 21071-1-AP-20ul

Pricing

Tested Reactivity	human, mouse
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15214 Product name: Recombinant human ADORA2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 278-332 aa of BC025722 Sequence: LSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL Predict reactive species
Full Name	adenosine A2b receptor
Calculated Molecular Weight	332 aa, 36 kDa
Observed Molecular Weight	36 kDa
GenBank Accession Number	BC025722
Gene Symbol	ADORA2B
Gene ID (NCBI)	136
RRID	AB_2918069
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P29275
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Ordering

Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:

[email protected]

Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.

More from Proteintech.