Proteintech, 21249-1-AP-20ul, AGRP Polyclonal antibody

Name: AGRP Polyclonal antibody
Brand: Proteintech
SKU: 21249-1-AP-20ul

The AGRP (21249-1-AP) by Proteintech is a Polyclonal antibody targeting AGRP in IHC, ELISA applications with reactivity to human, mouse samples

Available Catalog Numbers

Catalog Number: 21249-1-AP-20ul

Pricing

Tested Reactivity	human, mouse
Cited Reactivity	rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15752 Product name: Recombinant human AGRP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-132 aa of BC110443 Sequence: GAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT Predict reactive species
Full Name	agouti related protein homolog (mouse)
Calculated Molecular Weight	132 aa, 14 kDa
GenBank Accession Number	BC110443
Gene Symbol	AGRP
Gene ID (NCBI)	181
RRID	AB_2878831
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O00253
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Ordering

Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:

[email protected]

Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.

More from Proteintech.