Proteintech, 26634-1-AP-20ul, AADAC Polyclonal antibody

Name: AADAC Polyclonal antibody
Brand: Proteintech
SKU: 26634-1-AP-20ul

The AADAC (26634-1-AP) by Proteintech is a Polyclonal antibody targeting AADAC in WB, IHC, ELISA applications with reactivity to human, mouse samples

Available Catalog Numbers

Catalog Number: 26634-1-AP-20ul

Pricing

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag24377 Product name: Recombinant human AADAC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-96 aa of BC032309 Sequence: PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVP Predict reactive species
Full Name	arylacetamide deacetylase (esterase)
Calculated Molecular Weight	399 aa, 46 kDa
Observed Molecular Weight	46 kDa
GenBank Accession Number	BC032309
Gene Symbol	AADAC
Gene ID (NCBI)	13
RRID	AB_2880583
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P22760
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Ordering

Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:

[email protected]

Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.

More from Proteintech.