Proteintech, 67484-1-Ig-20ul, AHCYL2 Monoclonal antibody

Name: AHCYL2 Monoclonal antibody
Brand: Proteintech
SKU: 67484-1-Ig-20ul

The AHCYL2 (67484-1-Ig) by Proteintech is a Monoclonal antibody targeting AHCYL2 in WB, IHC, ELISA applications with reactivity to Human samples

Available Catalog Numbers

Catalog Number: 67484-1-Ig-20ul

Pricing

Tested Reactivity	Human
Host / Isotype	Mouse / IgG2a
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag19614 Product name: Recombinant human AHCYL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-115 aa of BC024325 Sequence: MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEA Predict reactive species
Full Name	S-adenosylhomocysteine hydrolase-like 2
Calculated Molecular Weight	611 aa, 67 kDa
Observed Molecular Weight	67 and 57 kDa
GenBank Accession Number	BC024325
Gene Symbol	AHCYL2
Gene ID (NCBI)	23382
RRID	AB_2882711
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q96HN2
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Ordering

Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:

[email protected]

Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.

More from Proteintech.