| Tested Reactivity | Mosquito |
|---|---|
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag30168 Product name: Recombinant mosquito AgBR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-365 aa of XM_001844620 Sequence: AFLLKDSVEYVHLAAFDQKTPERNPSEADYTSPLYEPTGDGERIAANNVDAEVRYWLTNKTPPNKIVVGIASYGRGWKLPEDSGPVPPVTVDGPSPAGPYTNESGRYSYAEICTQLPGSRLSTLDG Predict reactive species |
| Full Name | AgBR1 |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | XM_001844620 |
| Gene Symbol | AgBR1 |
| Gene ID (NCBI) | 6034353 |
| RRID | AB_2918512 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | B0W7I8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:
Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.
![Proteintech ChromoTek Nano-Secondary® anti-human IgG/anti-rabbit IgG, recombinant VHH, Alexa Fluor® 488 [CTK0101, CTK0102]](/img/defaultimage.webp)
