Proteintech, 84322-4-RR-100ul, A1CF Recombinant monoclonal antibody

Name: A1CF Recombinant monoclonal antibody
Brand: Proteintech
SKU: 84322-4-RR-100ul

The A1CF (84322-4-RR) by Proteintech is a Recombinant antibody targeting A1CF in WB, IHC, ELISA applications with reactivity to human samples

Available Catalog Numbers

Catalog Number: 84322-4-RR-100ul

Pricing

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag22929 Product name: Recombinant human A1CF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC054873 Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR Predict reactive species
Full Name	APOBEC1 complementation factor
Calculated Molecular Weight	594 aa, 65 kDa
Observed Molecular Weight	65 kDa
GenBank Accession Number	BC054873
Gene Symbol	A1CF
Gene ID (NCBI)	29974
RRID	AB_3671864
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purfication
UNIPROT ID	Q9NQ94
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Ordering

Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:

[email protected]

Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.

More from Proteintech.