Merck, 374087-200UG, Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

General description
Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.
Protein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.
Recognizes the ~32 kDa HO-1 protein.
Immunogen
Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
Application
Immunoblotting (4 µg/ml, chemiluminescence)
Immunocytochemistry (1:1000)
Immunoprecipitation (20 µg/ml)
Packaging
Please refer to vial label for lot-specific concentration.
Physical form
In PBS, 50% glycerol.
Preparation Note
Following initial thaw, aliquot and freeze (-20°C).
Other Notes
Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J.2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.
Legal Information
CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Toxicity: Standard Handling (A)