Merck, SAB5702453-100UL, Anti-Contactin 2 Antibody, clone 4R2S3, Rabbit Monoclonal
Size:100 μL, AXT, FAME5, TAG-1, TAX, TAX1
Catalog Number: SAB5702453-100UL
Send an RFQ.
Pack Size100 µL
Loading…
| NACRES | NA.46 |
|---|---|
| UNSPSC Code | 12352203 |
| biological source | rabbit |
| conjugate | unconjugated |
| material | colorless |
| clone | 4R2S3, monoclonal |
| form | liquid |
| mol wt | 150 kDa |
| concentration | 0.8 mg/mL |
| technique(s) | western blot: 1:500 - 1:2000 |
| color | colorless |
| isotype | IgG |
| immunogen sequence | MGTATRRKPHLLLVAAVALVSSSAWSSALGSQTTFGPVFEDQPLSVLFPEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNP |
| UniProt accession no. | Q02246 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Quality Level | 100 |
| Gene Information | human ... CNTN2(6900) |
| species reactivity | human, rat |
Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:
Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.
