Merck, SAB5702898-100UL, Anti-FOXO3A Antibody, clone 8B9X5, Rabbit Monoclonal
Size:100 μL, AF6q21, FKHRL1, FKHRL1P2, FOXO2, FOXO3A
Catalog Number: SAB5702898-100UL
Send an RFQ.
Pack Size100 µL
Loading…
| NACRES | NA.46 |
|---|---|
| UNSPSC Code | 12352203 |
| biological source | rabbit |
| conjugate | unconjugated |
| material | colorless |
| clone | 8B9X5, monoclonal |
| form | liquid |
| mol wt | 90 kDa |
| Quality Level | 100 |
| Gene Information | human ... FOXO3(2309) |
| species reactivity | mouse |
| concentration | 1 mg/mL |
| technique(s) | western blot: 1:500 - 1:2000 |
| color | colorless |
| isotype | IgG |
| immunogen sequence | SPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG |
| UniProt accession no. | O43524 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:
Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.
