Biolegend, 446709, Recombinant Human Uncarboxylated Osteocalcin (ELISA Std.)
4pack
Catalog Number: 446709
Send an RFQ.
Category
Loading…
| Source | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (synthetic peptide) |
|---|---|
| Molecular Mass | 33.2 kD |
| Purity | > 90% |
| Formulation | Lyophilized in sterile-filtered PBS, pH 7.2, containing 1% BSA, 0.09% sodium azide, and protease inhibitors |
| Concentration | Lot-specific (to obtain lot-specific concentration and expiration, please enter the lot number in our Certificate of Analysis online tool.) |
| Storage & Handling | Unopened vials can be stored between 2°C and 8°C until the expiration date. Prior to use, reconstitute the lyophilized powder with 0.2 mL of PBS containing a carrier protein (e.g., 1% BSA, protease free), pH7.4. Re-cap vial, vortex. Allow the reconstituted standard to sit at room temperature for 15 minutes, vortex again to mix completely. The reconstituted standard stock solution can be aliquoted into polypropylene vials and stored at -70°C for up to one month. Do not re-use diluted standards. Avoid repeated freeze/thaw cycles. |
| Activity | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPVIt is a synthetic peptide (did not test activity) |
| Application | ELISA - Quality tested |
Unless otherwise stated, the minimum order amount is USD 1,000.
For orders below USD 1,000, an additional handling fee may apply, or we may arrange local delivery / local handover where available.
All quotations are subject to final confirmation, including product availability, lead time, batch information, shipping cost, and applicable export or handling requirements.
For quotation requests, please send an RFQ from website or contact:
Please send inquiries directly to us in the “To” field. Emails sent via BCC, mass mailing, or with unrelated recipients may be automatically filtered and will not be processed.
| Recommended Usage |
|---|
| Each lot of this protein is quality control tested by ELISA assay. For use as an ELISA standard, a standard curve comprised of doubling dilutions from 37.5 - 2400 pg/mL is suggested. It is recommended that the reagent be titrated for optimal performance for each application. |
| Application Notes | This Uncarboxylated Osteocalcin protein is useful as a standard for a human Osteocalcin sandwich ELISA, using unlabeled 8H4 antibody (Cat. No. 538202) as capture and biotinylated 4B6 antibody (Cat. No. 538304) as detection. |
|---|
| Structure | Monomer |
|---|
| Distribution | Osteocalcin is produced by osteoblasts as a 49 amino acid protein, which contains 3 glutamine acid residues (Glu 17, 21, and 24) that are gamma carboxylated in a vitamin K dependent manner. |
|---|
| Function | Once binded under/uncarboxylated forms act as hormones promoting β-cell proliferation, adiponectin secretion, insulin sensitivity, glucose tolerance, and testosterone biosynthesis. In patients with diabetes, reduced serum levels of osteocalcin are negatively correlated with obesity and insulin resistance. Furthermore, supporting studies in mice have suggested potential therapeutic applications for osteocalcin in both obesity and insulin resistance. |
|---|
| Interaction | GPRC6A, insulin, pancreatic β-cells, Ley-dig cells, adiponectin |
|---|
| Ligand/Receptor | Under/uncarboxylated forms can bind the receptor GPCR6a, calcium, and metal-binding. |
|---|
| Bioactivity | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPVImmunogen is a synthetic peptide (did not test activity) |
|---|
| Cell Type | Osteoblasts |
|---|
| Molecular Family | Hormones |
|---|
| Antigen References | Booth SL, et al. 2013. Nat Rev Endocrinol. 9:43. Diaz-Franco MC, et al. 2019. Mol Med Rep. 19:15-22. Karsenty G, et al. 2014. Mol Cell Endocrinol. 382:521. Zoch ML, et al. 2016. Bone. 82:42-9. |
|---|
| Gene ID | 632 |
|---|
| UniProt | View information about Uncarboxylated Osteocalcin on UniProt.org |
|---|
| Regulatory Status | RUO |
|---|
| Other Names | Osteocalcin, uncarboxylated osteocalcin, decarboxylated osteocalcin, 3xGlu, bone gamma-carboxyglutamate protein, Bone Gla Protein, BGP, OC, OCN, unOCN |
|---|
